HORDB

ID: hor006287
Uniprot ID: Q64387
Protein name: Neuropeptide 1
Gene name: Pnoc
Organism: Mus musculus (Mouse)
Family: Opioid neuropeptide precursor family
Source: animal
Expression: In embryonic brain, first detected at day 14 and in postnatal brain, levels increase in day 1 and day 18. Levels decrease significantly in adults.|Brain and spinal cord. Low levels in kidney and spleen.
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001515 opioid peptide activity; GO:0031628 opioid receptor binding; GO:0048018 receptor ligand activity
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007270 neuron-neuron synaptic transmission; GO:0007600 sensory perception; GO:0019233 sensory perception of pain
GO CC: GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0030425 dendrite; GO:0043025 neuronal cell body; GO:0043679 axon terminus; GO:0097060 synaptic membrane

Sequence: MPRVRSLVQVRDAEPGADAEPGADAEPGADDAEEVEQKQLQ
Length: 41(98-138)
Propeptide: MKILFCDVLLLSLLSSVFSSCPRDCLTCQEKLHPAPDSFNLKTCILQCEEKVFPRPLWTVCTKVMASGSGQLSPADPELVSAALYQPKASEMQHLKRMPRVRSLVQVRDAEPGADAEPGADAEPGADDAEEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Signal peptide: MKILFCDVLLLSLLSSVFS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development. When administered intracerebroventricu
Mechanism: NA
Cross BBB: NA
Target: Oprl1
Target Unid: P35377
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006287_AF2.pdb

hor006287_ESM.pdb

Mass:	508939	Formula:	C181H293N55O69S
Absent amino acids:	CFHINTWY	Common amino acids:	A
pI:	3.83	Basic residues:	4
Polar residues:	4	Hydrophobic residues:	13
Hydrophobicity:	-96.1	Boman Index:	-11649
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	64.39
Instability Index:	5555.61	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 8645247
Title: Structure and regional distribution of nociceptin/orphanin FQ precursor.
PubMed ID: 7503733
Title: N23K, a gene transiently up-regulated during neural differentiation, encodes a precursor protein for a newly identified neuropeptide nociceptin.
PubMed ID: 8710928
Title: Structure, tissue distribution, and
PubMed ID: 8663129
Title:
PubMed ID: 8670093
Title:
PubMed ID: 9601687
Title: